PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009128203.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Trihelix
Protein Properties Length: 556aa    MW: 63119.9 Da    PI: 6.3492
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009128203.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix902.7e-2855139187
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                     rW++qe+laL+++r++m+ ++r++  k+plWeevs+km e g+ r++k+Ckek+en+ k++k++keg+ ++++++  t+++fdqlea
  XP_009128203.1  55 RWPRQETLALLKIRSDMGIAFRDATVKGPLWEEVSRKMGELGYIRNAKKCKEKFENVYKYHKRTKEGRTEKSEGK--TYRFFDQLEA 139
                     8********************************************************************975544..6*******85 PP

2trihelix100.31.6e-31368453187
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                     rW+k  + aLi++r++++++++++  k+plWe++s+ mr+ gf+r++k+Ckekwen+nk+ykk+ke++kkr +e+s+tcpyf+ql+a
  XP_009128203.1 368 RWPKVGIEALIKLRTNLDSKYEENGPKGPLWEDISAGMRRLGFNRNSKRCKEKWENINKYYKKVKESNKKR-PEDSKTCPYFHQLDA 453
                     8*********************************************************************8.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.03852114IPR001005SANT/Myb domain
PfamPF138374.1E-1754140No hitNo description
CDDcd122034.67E-2254119No hitNo description
PROSITE profilePS500906.95754112IPR017877Myb-like domain
PROSITE profilePS500906.191361425IPR017877Myb-like domain
SMARTSM007171.7365427IPR001005SANT/Myb domain
CDDcd122031.69E-24367432No hitNo description
PfamPF138373.1E-21367454No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010192Biological Processmucilage biosynthetic process
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 556 aa     Download sequence    Send to blast
MMQQGDSTTT SAATEAVPLQ HNESAATEAA AATSAAVGAF EVSEEMSDRG FGGNRWPRQE  60
TLALLKIRSD MGIAFRDATV KGPLWEEVSR KMGELGYIRN AKKCKEKFEN VYKYHKRTKE  120
GRTEKSEGKT YRFFDQLEAL ETHSTSSSHH HQPQSQPHNN SSMFSTPPPV TTVIPPTTNI  180
TPSFPNISGD FLSDNSTSSS YSTSSDVEVG DTKTTTTRRK KRKRKWKEFF ERLMKQVVGK  240
QEELQRKFLE TVEKREHERM VREESWRVQE IARINREHEI LAQERSMSAA KDAAVTAFLQ  300
KFSEKPNPQC QSIAQPQMEV IHNNQQATQQ QTPPPRPPQP LSALDTMKTD NGDQNMTPVS  360
AGALSSSRWP KVGIEALIKL RTNLDSKYEE NGPKGPLWED ISAGMRRLGF NRNSKRCKEK  420
WENINKYYKK VKESNKKRPE DSKTCPYFHQ LDALYRERNK FHTNNNVASS SSTSGLVKPD  480
NSVPLMVQPE QQWPPVTATT VGATVKPDQH PPQPLDQNFD DEEGTDQEEY DDEEDDEENQ  540
EEEGGEFELV PSNNKD
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1218223RKKRKR
2218224RKKRKRK
3219224KKRKRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00243DAPTransfer from AT1G76880Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892031e-166AC189203.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB006H21, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009128203.10.0PREDICTED: trihelix transcription factor GT-2-like
SwissprotQ391171e-145TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLM4CVN80.0M4CVN8_BRARP; Uncharacterized protein
STRINGBra008285.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM48492553
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.10.0Trihelix family protein